Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 1 (TAAR1)

This Recombinant Human Trace amine-associated receptor 1 (TAAR1) spans the amino acid sequence from region 1-339aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TaR-1; Trace amine receptor 1 ; TAAR1 ; TA1

UniProt

Q96RJ0

Expression Region

1-339aa

Tag

C-terminal Twin-Strep-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Pyrazoleboronic Acid Pinacol Ester
TRC-P842200-2.5G 2.5 g

4-Pyrazoleboronic Acid Pinacol Ester

Sign In for Pricing
View Details
3-(p-Anisyl)-6-hydrazinopyridazine
TRC-A674000-250MG 250 mg

3-(p-Anisyl)-6-hydrazinopyridazine

Sign In for Pricing
View Details
RTL10 (NM_024627) Human Recombinant Protein
TP303371M 100 µg

RTL10 (NM_024627) Human Recombinant Protein

Sign In for Pricing
View Details
Cyanoacetic Acid-13C2
TRC-C987482-250MG 250 mg

Cyanoacetic Acid-13C2

Sign In for Pricing
View Details
MT ND3 (ND3) Rabbit Polyclonal Antibody
TA371433 100 µL

MT ND3 (ND3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIX2 Rabbit Polyclonal Antibody
ER2001-39 100 µL

SIX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details