Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Glucose-6-phosphatase 3 (g6pc3)

This Recombinant Danio rerio Glucose-6-phosphatase 3 (g6pc3) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Glucose-6-phosphatase 3, G-6-Pase 3, G6Pase 3, EC= 3.1.3.9

UniProt

A1A5Z0

Expression Region

1-339

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLYRQGVWMAEALQQNSRSLEDLWLVASHMGDPKAAVLLVFPVVFYIHRRTGIAVLWV AALSEWLNLVFKWILFGERPYWWIGQSGLFSEKPPEVQQFQSTCESGPGSPSGHAMVTSA VWWVIISSLASFSQAYTGSKILSAVLYLLYAVFLGCVGLSRIFILAHFPHQVVAGLLTGV LLGVFLKRSVPERRPLLFFFRFSMALLGAALIFHAVLEKTGIDLSWSISLAKRWCSRSEW VRMDTAPFSSLNRDAGVLLGLGLAQYWKPGGWTLPRAPRTLCLALSSLALHYISRFPLPT VPPLLFYSLFFLKYSIVPQVVMVLVPGFVHLLTAKPKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details