Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Organic solute transporter subunit alpha (OSTA)

This Recombinant Bovine Organic solute transporter subunit alpha (OSTA) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Organic solute transporter subunit alpha, OST-alpha

UniProt

Q3T124

Expression Region

1-340

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPDRTQIRLDPRYTADLLEILKTNYSVPSACFSYPPTAAQLLRALGPVDISLMVIMTLF VLGSIAIFLEAAVYLHKNTRCPIKRKTLIWCSSSPTIVSAFSCFGLWIPRALTLVEMAIT TFYSMCFYLLMQAMVEGFGGKEAVLRTLKDTPVMIHTGPCCCCCPCCPRIKITRKRLQLL LLGPIQYAFFKISLTLVGLFLIPDGIFDPSDISEGSTALWINTFLGVSTLSALWTIGIIF RQARLHLGEQNIGAKFVLFQALLILSALQPSIFSVLASGGQIACSPPFSSKIRSQVMNCH LLILESFLITVLTRIYYRRKDDKLGYEPFSSPDQDLNLKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF488A conjugate, 0.1mg/mL
BNC880780-100 1x 100 µL

HSP60 (HSPD1/780), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF594 conjugate, 0.1mg/mL
BNC940172-100 1x 100 µL

CD45 / LCA (135-4C5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details