Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5T3 (OR5T3)

This Recombinant Human Olfactory receptor 5T3 (OR5T3) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Olfactory receptor 5T3, Olfactory receptor OR11-178

UniProt

Q8NGG3

Expression Region

1-340

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSTFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMFILTGFTDDFELQVFLFLL FFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKNK SISFIGCATQMLLFVTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASYV AGILHATIHIVATFSLSFCGSNEIRHVFCDMPPLLAISCSDTHTNQLLLFYFVGSIEIVT ILIVLISCDFILLSILKMHSAKGRQKAFSTCGSHLTGVTIYHGTILVSYMRPSSSYASDH DIIVSIFYTIVIPKLNPIIYSLRNKEVKKAVKKMLKLVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Assay Plates
DP35F-96-BLK-S-IWL 100 Units/Case

Assay Plates

Sign In for Pricing
View Details
Tissue FFPE Sections, Peritoneum
CS712909 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details
Gab2 (Ab-623) Antibody
8B8350-AAT 50 µg

Gab2 (Ab-623) Antibody

Sign In for Pricing
View Details
ATP-GloTM Bioluminometric Cell Viability Assay Kit (200 assays)
#30020-1 1 Kit

ATP-GloTM Bioluminometric Cell Viability Assay Kit (200 assays)

Sign In for Pricing
View Details
Human IL-4 Recombinant Rabbit Monoclonal Antibody [PS00-66] - BSA and Azide free (Detector)
HA721231 100 µL

Human IL-4 Recombinant Rabbit Monoclonal Antibody [PS00-66] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560479 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details