Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Organic solute transporter subunit alpha (Osta)

This Recombinant Mouse Organic solute transporter subunit alpha (Osta) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Organic solute transporter subunit alpha, OST-alpha

UniProt

Q8R000

Expression Region

1-340

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFL TTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAIT SFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLL LLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILF RQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCH MLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRAP (N-term) Rabbit Polyclonal Antibody
AP52742PU-N 400 µL

MRAP (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PODXL Mouse Monoclonal Antibody [Clone ID: OTI9C2]
CF807762 100 µg

PODXL Mouse Monoclonal Antibody [Clone ID: OTI9C2]

Sign In for Pricing
View Details
RABIF Rabbit Polyclonal Antibody
TA362401 100 µL

RABIF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FMO3 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF810418 100 µg

FMO3 Mouse Monoclonal Antibody [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Human SHANK1 activation kit by CRISPRa
GA109481 1 Kit

Human SHANK1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648051 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details