Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Organic solute transporter subunit alpha (Osta)

This Recombinant Mouse Organic solute transporter subunit alpha (Osta) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Organic solute transporter subunit alpha, OST-alpha

UniProt

Q8R000

Expression Region

1-340

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFL TTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAIT SFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLL LLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILF RQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCH MLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A3]
TA803508AM 100 µL

MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS623332 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
AATOM™ 633 azide
70273-AAT 1 mg

AATOM™ 633 azide

Sign In for Pricing
View Details
EMC2 Antibody
OC-2455-01 50 μL

EMC2 Antibody

Sign In for Pricing
View Details
EMC2 Antibody
OC-2455-02 100 µL

EMC2 Antibody

Sign In for Pricing
View Details
EMC2 Antibody
OC-2455-03 1 mL

EMC2 Antibody

Sign In for Pricing
View Details