Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) C5a anaphylatoxin chemotactic receptor (C5AR1)

This Recombinant Macaca mulatta (Rhesus macaque) C5a anaphylatoxin chemotactic receptor (C5AR1) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD_antigen= CD88

UniProt

P79188

Expression Region

1-340

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TPDYGHYDDKDTLDANTPVDKTSNTLRVPDILALVIFAVVFLVGVLRNALVVWVTAFEAK RTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNMYASILLL ATISADRFLLVFNPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVL CGVDHGHDKRRERAVAIARLVLGFVWPLLTLTMCYTFLLLRTWSRRATRSTKTLKVVVAV VASFFIFWLPYQVTGMMMSFLEPSSPTFLLLKKLDSLCISFAYINCCINPIIYVVAGQGF QGRLRKSLPSLLRNVLTEESMVRESKSFTRSTVDTMAQKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF740 conjugate, 0.1mg/mL
BNC741541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF594 conjugate, 0.1mg/mL
BNC941782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details