Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Adenosine receptor A2b (ADORA2B)

This Recombinant Chicken Adenosine receptor A2b (ADORA2B) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Adenosine receptor A2b, Adenosine receptor 2b

UniProt

O13076

Expression Region

1-340

Origin

Gallus gallus (Chicken)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTMKTTYIVLELIIAVLSIAGNVLVCWAVAINSTLKNATNYFLVSLAVADIAVGLLAIP FAITISIGFQVDFHSCLFFACFVLVLTQSSIFSLLAVAIDRYLAIKIPLRYNSLVTGKRA RGLIAVLWLLSFVIGLTPLMGWNKAMSGCPNSTNETGADHGAGHHGCFISCLFENVVTMS YMVYFNFFGCVLLPLIIMLGIYIKIFMVACKQLHQIELMGNSRTTLQKEVHAAKSLAIIV GLFAFCWLPLHILNCITHFHEEFSKSKPEWVMYVAIILSHANSVINPIIYAYRIRDFRYT FHKIISKILCKTDDFPKCTTDNNQHLTVTNVNAPAASVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ihh (4B9) Rabbit Monoclonal Antibody
E28M0289 100 µL

Ihh (4B9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse LGALS1 Protein, His, E.coli-1mg
QP12557-1mg 1mg

Recombinant Mouse LGALS1 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Dynemicin P
orb3024053-01 50 mg

Dynemicin P

Sign In for Pricing
View Details
Dynemicin P
orb3024053-02 10 mg

Dynemicin P

Sign In for Pricing
View Details
RP2 Antibody
A33515-50UL 50 μL

RP2 Antibody

Sign In for Pricing
View Details
PRH2 (NM_005042) Human Tagged Lenti ORF Clone
RC210681L3 10 µg

PRH2 (NM_005042) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details