Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Probable D, D-dipeptide transport system permease protein ddpB (ddpB)

This Recombinant Escherichia coli Probable D, D-dipeptide transport system permease protein ddpB (ddpB) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Probable D, D-dipeptide transport system permease protein ddpB

UniProt

P77308

Expression Region

1-340

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGI LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Leucine--tRNA ligase, mitochondrial (NAM2) , partial
MBS1098987 Inquire

Recombinant Saccharomyces cerevisiae Leucine--tRNA ligase, mitochondrial (NAM2) , partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans B0495.9 Protein (aa 1-267)
VAng-Ly3063-50gEcoli 50 µg (E. coli)

Recombinant Caenorhabditis Elegans B0495.9 Protein (aa 1-267)

Sign In for Pricing
View Details
Scoca Antibody
orb861348 2 mg

Scoca Antibody

Sign In for Pricing
View Details
Rat Anti Mouse CD86 FITC
MBS140176-01 0.5 mg

Rat Anti Mouse CD86 FITC

Sign In for Pricing
View Details
Rat Anti Mouse CD86 FITC
MBS140176-02 1 mg

Rat Anti Mouse CD86 FITC

Sign In for Pricing
View Details
Rat Anti Mouse CD86 FITC
MBS140176-03 5x 1 mg

Rat Anti Mouse CD86 FITC

Sign In for Pricing
View Details