Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-activating factor receptor (Ptafr)

This Recombinant Mouse Platelet-activating factor receptor (Ptafr) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q62035

Expression Region

1-341

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diboc Biotin Methyl Ester
446621-01 1 mg

Diboc Biotin Methyl Ester

Sign In for Pricing
View Details
Diboc Biotin Methyl Ester
446621-02 2.5 mg

Diboc Biotin Methyl Ester

Sign In for Pricing
View Details
Human fragile histidine triad (FHIT) ELISA Kit
CSB-E14182h-01 48 Tests

Human fragile histidine triad (FHIT) ELISA Kit

Sign In for Pricing
View Details
Human fragile histidine triad (FHIT) ELISA Kit
CSB-E14182h-02 96 Tests

Human fragile histidine triad (FHIT) ELISA Kit

Sign In for Pricing
View Details
Human fragile histidine triad (FHIT) ELISA Kit
CSB-E14182h-03 5x 96 Tests

Human fragile histidine triad (FHIT) ELISA Kit

Sign In for Pricing
View Details
Human fragile histidine triad (FHIT) ELISA Kit
CSB-E14182h-04 10x 96 Tests

Human fragile histidine triad (FHIT) ELISA Kit

Sign In for Pricing
View Details