Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-activating factor receptor (Ptafr)

This Recombinant Mouse Platelet-activating factor receptor (Ptafr) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q62035

Expression Region

1-341

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710
271190-01 1 mg

4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710

Sign In for Pricing
View Details
4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710
271190-02 2 mg

4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710

Sign In for Pricing
View Details
4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710
271190-03 5 mg

4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710

Sign In for Pricing
View Details
4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710
271190-04 10 mg

4-[2-[5,6-Dihydro-5,5-dimethyl-8- (4-methylphenyl) -2-naphthalenyl]ethynyl]benzoic acid sodium salt discontinued. See 001710

Sign In for Pricing
View Details
RNF165 Rabbit Polyclonal Antibody (BF350)
orb2377869 100 µL

RNF165 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw)
MBS7024546-01 0.02 mg

Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw)

Sign In for Pricing
View Details