Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-3 (srb-3)

This Recombinant Serpentine receptor class beta-3 (srb-3) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-3, Protein srb-3

UniProt

Q95ZY2

Expression Region

1-341

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLETNDSVCELAYQLAYHPVYRSSQFWSMLVSSLSIPALIYFITRKIFFLHFHGNLKCLL IVYFICNLLFSMALCFAFFYQFLIPFFVTSKCQLLINTTLFKWGQICSFLLLTSSMLLPI GFSIERFVALGNAQKYESSRTFLGPVIIFIIIAVDFSIIFSVYKNEPFTEGFYSFILVPS TTASQINMYFFVLLFVKIFNLLLNCILLRIHKKIRIKYYSLSVRYEMEEILQSSKFTFII RFTHLLFFGFYVVVILFVRIMGESFFNGTLNYSVARGVFCTVPTYNLIIVIIGIKSLRHL NLQRLNKVQSTVQIKSTGKEGSKNYEDIITNYWDSVSSRTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB (Phospho-S111) Rabbit Polyclonal Antibody
orb665517-01 30 µL

CREB (Phospho-S111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CREB (Phospho-S111) Rabbit Polyclonal Antibody
orb665517-02 50 μL

CREB (Phospho-S111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CREB (Phospho-S111) Rabbit Polyclonal Antibody
orb665517-03 100 µL

CREB (Phospho-S111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CREB (Phospho-S111) Rabbit Polyclonal Antibody
orb665517-04 200 µL

CREB (Phospho-S111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEFH Rabbit Polyclonal Antibody
orb412733-01 30 µL

NEFH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEFH Rabbit Polyclonal Antibody
orb412733-02 50 μL

NEFH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details