Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-3 (srb-3)

This Recombinant Serpentine receptor class beta-3 (srb-3) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-3, Protein srb-3

UniProt

Q95ZY2

Expression Region

1-341

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLETNDSVCELAYQLAYHPVYRSSQFWSMLVSSLSIPALIYFITRKIFFLHFHGNLKCLL IVYFICNLLFSMALCFAFFYQFLIPFFVTSKCQLLINTTLFKWGQICSFLLLTSSMLLPI GFSIERFVALGNAQKYESSRTFLGPVIIFIIIAVDFSIIFSVYKNEPFTEGFYSFILVPS TTASQINMYFFVLLFVKIFNLLLNCILLRIHKKIRIKYYSLSVRYEMEEILQSSKFTFII RFTHLLFFGFYVVVILFVRIMGESFFNGTLNYSVARGVFCTVPTYNLIIVIIGIKSLRHL NLQRLNKVQSTVQIKSTGKEGSKNYEDIITNYWDSVSSRTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKRC01399-96W - Decorin ELISA Kit (Rat)
OKRC01399-96W 96 Well

OKRC01399-96W - Decorin ELISA Kit (Rat)

Sign In for Pricing
View Details
Phospho-OSR1 (T310) Antibody
MBS9203397-01 0.08 mL

Phospho-OSR1 (T310) Antibody

Sign In for Pricing
View Details
Phospho-OSR1 (T310) Antibody
MBS9203397-02 0.4 mL

Phospho-OSR1 (T310) Antibody

Sign In for Pricing
View Details
Phospho-OSR1 (T310) Antibody
MBS9203397-03 5x 0.4 mL

Phospho-OSR1 (T310) Antibody

Sign In for Pricing
View Details
ELISA kit for Mouse DCLK1 (Doublecortin Like Kinase 1)
E-EL-M0326 96 Tests

ELISA kit for Mouse DCLK1 (Doublecortin Like Kinase 1)

Sign In for Pricing
View Details
Srebf2 ORF Vector (Rat) (pORF)
ORF077007 1.0 µg DNA

Srebf2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details