Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-1 (srb-1)

This Recombinant Serpentine receptor class beta-1 (srb-1) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-1, Protein srb-1

UniProt

Q95ZY0

Expression Region

1-341

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIENKCDLAFEVTYHPLYRAAQFWTFIFSTLAVPALFIFLLKQIFPLPFHGNIKFMLIS YFLSAFLFAVVLALTFGYHILVPLFITSKCDLIIQPYLFKVGQLSLTLFITLQMIMPFGF SIERIIALRMAKSYENVRTVLGPLLIFVLIGIDLILLFTVFRDESFNDSFISFILIPATT AQTFNSYCWILLYAELGNLLCNCIILLVHSKFKTKFLHQQRSLSVRYELEEISQTSKFTL IVSFTHILFIGWYLGVTIFIRTVGETFFGSYINYTVARGVYISVPTYNLTIVFVGIKALS FMNLKRQNNVQSKVQIKSTGSEGARNYENAIASYWNSVSKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOD3 Recombinant Antibody, RBITC Conjugated
bsm-61605R-RBITC-TR 20 µL

SOD3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Caspase-3 (D3R6Y) Rabbit Monoclonal Antibody (IHC Formulated)
CST 14214S 100 µL

Caspase-3 (D3R6Y) Rabbit Monoclonal Antibody (IHC Formulated)

Sign In for Pricing
View Details
N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide
OR1079571-01 100 mg

N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide

Sign In for Pricing
View Details
N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide
OR1079571-02 250 mg

N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide

Sign In for Pricing
View Details
N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide
OR1079571-03 1 g

N- (2-Methylbenzo[D]Oxazol-5-Yl) Acetamide

Sign In for Pricing
View Details
Sulfo-Cyanine5 amine, 1 mg
133C0 1 mg

Sulfo-Cyanine5 amine, 1 mg

Sign In for Pricing
View Details