Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-1 (srb-1)

This Recombinant Serpentine receptor class beta-1 (srb-1) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-1, Protein srb-1

UniProt

Q95ZY0

Expression Region

1-341

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIENKCDLAFEVTYHPLYRAAQFWTFIFSTLAVPALFIFLLKQIFPLPFHGNIKFMLIS YFLSAFLFAVVLALTFGYHILVPLFITSKCDLIIQPYLFKVGQLSLTLFITLQMIMPFGF SIERIIALRMAKSYENVRTVLGPLLIFVLIGIDLILLFTVFRDESFNDSFISFILIPATT AQTFNSYCWILLYAELGNLLCNCIILLVHSKFKTKFLHQQRSLSVRYELEEISQTSKFTL IVSFTHILFIGWYLGVTIFIRTVGETFFGSYINYTVARGVYISVPTYNLTIVFVGIKALS FMNLKRQNNVQSKVQIKSTGSEGARNYENAIASYWNSVSKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABR Rabbit Polyclonal Antibody
TA373166 100 µL

ABR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Ceruloplasmin ELISA Kit
MBS135935-01 1 Kit

Human Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details
Human Ceruloplasmin ELISA Kit
MBS135935-02 5x 1 Kit

Human Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details
FAM13A Antibody
E51A10596 100 µL

FAM13A Antibody

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-human CD14
GT14806 25 Tests

Brilliant Violet 605™ anti-human CD14

Sign In for Pricing
View Details
PIK3R6 Blocking Peptide
MBS822460-01 1 mg

PIK3R6 Blocking Peptide

Sign In for Pricing
View Details