Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Thromboxane A2 receptor (Tbxa2r)

This Recombinant Rat Thromboxane A2 receptor (Tbxa2r) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Thromboxane A2 receptor, TXA2-R, Prostanoid TP receptor, TXR2

UniProt

P34978

Expression Region

1-341

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syngr3 Mouse Gene Knockout Kit (CRISPR)
KN517061 1 Kit

Syngr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac FTY720 Phosphate
TRC-F805010-25MG 25 mg

rac FTY720 Phosphate

Sign In for Pricing
View Details
GALT Recombinant Rabbit Monoclonal Antibody [PSH02-88]
HA721876 100 µL

GALT Recombinant Rabbit Monoclonal Antibody [PSH02-88]

Sign In for Pricing
View Details
ReadiCleave™ ROXtra SSL-NHS ester
7052-AAT 1 mg

ReadiCleave™ ROXtra SSL-NHS ester

Sign In for Pricing
View Details
CLTCL1 Antibody
KC-17734-01 50 μL

CLTCL1 Antibody

Sign In for Pricing
View Details
CLTCL1 Antibody
KC-17734-02 100 µL

CLTCL1 Antibody

Sign In for Pricing
View Details