Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Platelet-activating factor receptor (Ptafr)

This Recombinant Rat Platelet-activating factor receptor (Ptafr) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P46002

Expression Region

1-341

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CRTC1 Polyclonal Antibody
TMAB-04704-01 50 μL

Anti-CRTC1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CRTC1 Polyclonal Antibody
TMAB-04704-02 100 µL

Anti-CRTC1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CRTC1 Polyclonal Antibody
TMAB-04704-03 200 µL

Anti-CRTC1 Polyclonal Antibody

Sign In for Pricing
View Details
Mmu-miR-5124a miRNA Inhibitor
CIM1067-01 10 nmol

Mmu-miR-5124a miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-5124a miRNA Inhibitor
CIM1067-02 20 nmol

Mmu-miR-5124a miRNA Inhibitor

Sign In for Pricing
View Details
Anti-GSTM4  (4B4)
YF-MA13348 100 ug

Anti-GSTM4 (4B4)

Sign In for Pricing
View Details