Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class r-10 (odr-10)

This Recombinant Serpentine receptor class r-10 (odr-10) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Serpentine receptor class r-10, Odorant response abnormal protein 10, Olfactory receptor 10

UniProt

A8XC92

Expression Region

1-342

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGELWLTLVDTADIVGFSMTFCVNIVLLFLLKNRGKNLGTYKHLMAFFSVFSIFYAIIE SILRPIMHIENATFFLISRKRFNYSTRLGKINSAFYCACFATSFVVSGVHFVYRFFASCK PHLLRSFNMPYLLLWPLGCSIPVMMWASVSYFLYPDTAFTEAAVTNVLNTHYHSIKKDNV SYIAYVYYQYDENGVRYVYLKNLLGCFVHYFVMSATFVVMFICGYLTWKTMRKHKTASDR TRQLQKQLFKALVLQTLIPTIFMYAPTGVMFIAPFFSINLNANANFIVFCSFLYPGLDPL ILILIIRDFRQTVFKFFCLRKKNSVDESRSTTRANMSQVATH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details