Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Platelet-activating factor receptor (PTAFR)

This Recombinant Goat Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q9GK76

Expression Region

1-342

Origin

Capra hircus (Goat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNSEPKKTGSGNITRCFEHYEKG SIPVLIIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQMQRNAEVKRRALWMVCTVLAV FVICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-7162-3p miRNA Antagomir
abx887744-01 10 nmol

Human hsa-miR-7162-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-7162-3p miRNA Antagomir
abx887744-02 20 nmol

Human hsa-miR-7162-3p miRNA Antagomir

Sign In for Pricing
View Details
Gpbp1 ORF Vector (Mouse) (pORF)
ORF046422 1.0 µg DNA

Gpbp1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Poglut1 shRNA (UAS) - Lentiviral mouse Poglut1 shRNA (UAS) (100)
GTR15223614 1 Vial

Lentiviral mouse Poglut1 shRNA (UAS) - Lentiviral mouse Poglut1 shRNA (UAS) (100)

Sign In for Pricing
View Details
MIPOL 1 (MIPOL1) (NM_001195296) Human Tagged ORF Clone
RC234107 10 µg

MIPOL 1 (MIPOL1) (NM_001195296) Human Tagged ORF Clone

Sign In for Pricing
View Details
Connexin 43 (Ab-368) Conjugated Antibody
orb1629309 100 µL

Connexin 43 (Ab-368) Conjugated Antibody

Sign In for Pricing
View Details