Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Platelet-activating factor receptor (PTAFR)

This Recombinant Goat Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q9GK76

Expression Region

1-342

Origin

Capra hircus (Goat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNSEPKKTGSGNITRCFEHYEKG SIPVLIIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQMQRNAEVKRRALWMVCTVLAV FVICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Γ- (6-Aminohexyl) -GTP-ATTO-532
NU-834-532 120 µL

Γ- (6-Aminohexyl) -GTP-ATTO-532

Sign In for Pricing
View Details
Innate Immunity Activator Protein (INAVA) Antibody
abx111642 100 µL

Innate Immunity Activator Protein (INAVA) Antibody

Sign In for Pricing
View Details
Mouse Anti Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit
CK-bio-26428-01 48 Tests

Mouse Anti Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit
CK-bio-26428-02 96 Tests

Mouse Anti Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit

Sign In for Pricing
View Details
INVS discontinued
538028-01 30ul

INVS discontinued

Sign In for Pricing
View Details
INVS discontinued
538028-02 100 µL

INVS discontinued

Sign In for Pricing
View Details