Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Platelet-activating factor receptor (PTAFR)

This Recombinant Goat Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q9GK76

Expression Region

1-342

Origin

Capra hircus (Goat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNSEPKKTGSGNITRCFEHYEKG SIPVLIIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQMQRNAEVKRRALWMVCTVLAV FVICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGE synthase (A-3) AC
sc-166308 AC 500 µg/mL - 25% ag

PGE synthase (A-3) AC

Sign In for Pricing
View Details
Rabbit Polyclonal ZMYM1 Antibody [Alexa Fluor 532]
NBP1-76523AF532 0.1 mL

Rabbit Polyclonal ZMYM1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Anti Human TBCB Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200UL
IRBAMLTBCBAP16200UL 200 µL

Rabbit Anti Human TBCB Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200UL

Sign In for Pricing
View Details
SPATA5 Antibody - middle region : Biotin (ARP52815_P050-Biotin)
ARP52815_P050-Biotin 100 µL

SPATA5 Antibody - middle region : Biotin (ARP52815_P050-Biotin)

Sign In for Pricing
View Details
Dihydrorhodamine 6G
OR1005070 1 Each

Dihydrorhodamine 6G

Sign In for Pricing
View Details
Lentiviral mouse Asb7 shRNA (UAS) - Lentiviral mouse Asb7 shRNA (UAS, RFP) plasmid
GTR15165589 1 Vial

Lentiviral mouse Asb7 shRNA (UAS) - Lentiviral mouse Asb7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details