Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Platelet-activating factor receptor (PTAFR)

This Recombinant Goat Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

Q9GK76

Expression Region

1-342

Origin

Capra hircus (Goat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNSEPKKTGSGNITRCFEHYEKG SIPVLIIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQMQRNAEVKRRALWMVCTVLAV FVICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SPINK2 Antibody [DyLight 594]
NBP2-82015DL594 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [DyLight 594]

Sign In for Pricing
View Details
GNB1 Rabbit Polyclonal Antibody
orb627412-01 50 µg

GNB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GNB1 Rabbit Polyclonal Antibody
orb627412-02 100 µg

GNB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human CEP104 shRNA (UAS) - Lentiviral human CEP104 shRNA (UAS) plasmid
GTR15316294 1 Vial

Lentiviral human CEP104 shRNA (UAS) - Lentiviral human CEP104 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MLLT3 Rabbit pAb
E45R30092N-100 100 µL

MLLT3 Rabbit pAb

Sign In for Pricing
View Details
PRKX Human qPCR Template Standard (NM_005044)
HK205879 1 Kit

PRKX Human qPCR Template Standard (NM_005044)

Sign In for Pricing
View Details