Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 3 (Taar3)

This Recombinant Rat Trace amine-associated receptor 3 (Taar3) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 3, TaR-3, Trace amine receptor 3

UniProt

Q5QD24

Expression Region

1-342

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRLIMYLLMTGAMVITIFGNLVIIISISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF HLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAAPALFSFGLVLSEANVSGMQSYE ILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALGNMPENTKG AGRNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYFN STCNPLIHGFFYPWFRKALEHIVSGKIFRSNSDTANLFPEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quantum™ Simply Cellular® anti-Rat IgG
817C 2x 7 mL - 280 Tests

Quantum™ Simply Cellular® anti-Rat IgG

Sign In for Pricing
View Details
NEK4 3'UTR GFP Stable Cell Line
TU065572 1.0 mL

NEK4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
S1PR3 Rabbit Polyclonal Antibody (Biotin)
orb2090614 100 µL

S1PR3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Mex3d shRNA (UAS) - Lentiviral mouse Mex3d shRNA (UAS, RFP) (100)
GTR15260976 1 Vial

Lentiviral mouse Mex3d shRNA (UAS) - Lentiviral mouse Mex3d shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-Lamin B2 Mouse mAb
MBS475446-01 0.1 mL

Anti-Lamin B2 Mouse mAb

Sign In for Pricing
View Details
Anti-Lamin B2 Mouse mAb
MBS475446-02 5x 0.1 mL

Anti-Lamin B2 Mouse mAb

Sign In for Pricing
View Details