Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 3 (Taar3)

This Recombinant Rat Trace amine-associated receptor 3 (Taar3) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 3, TaR-3, Trace amine receptor 3

UniProt

Q5QD24

Expression Region

1-342

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRLIMYLLMTGAMVITIFGNLVIIISISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF HLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAAPALFSFGLVLSEANVSGMQSYE ILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALGNMPENTKG AGRNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYFN STCNPLIHGFFYPWFRKALEHIVSGKIFRSNSDTANLFPEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%
88991-01 500 mg

ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%

Sign In for Pricing
View Details
ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%
88991-02 1 g

ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%

Sign In for Pricing
View Details
ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%
88991-03 5 g

ß-Nicotinamide Adenine Dinucleotide Sodium Salt (ß-NAD.Na) extrapure, 95%

Sign In for Pricing
View Details
CD97 (ADGRE5) (NM_001025160) Human Tagged ORF Clone
RG220165 10 µg

CD97 (ADGRE5) (NM_001025160) Human Tagged ORF Clone

Sign In for Pricing
View Details
E-cadherin CRISPR/Cas9 KO Plasmid (h)
sc-400031 20 µg

E-cadherin CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Monoclonal Antibody to Heparin Cofactor II (HCII)
TRV-0033327-01 20 µL

Monoclonal Antibody to Heparin Cofactor II (HCII)

Sign In for Pricing
View Details