Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 1, chloroplastic (PPT1)

This Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 1, chloroplastic (PPT1) spans the amino acid sequence from region 67-408.

Product Specifications

Product Name Alternative

Phosphoenolpyruvate/phosphate translocator 1, chloroplastic, OsPPT1

UniProt

Q69VR7

Expression Region

67-408

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPEQEDERRRGARDVAVAATAAAAGEAGAEEGGGLAKTLQLGALFGLWYLFNIYFNIYN KQVLKVFPYPINITNVQFAVGTVIALFMWITGILKRPKISGAQLAAILPLAMVHTMGNLF TNMSLGKVAVSFTHTIKAMEPFFSVLLSALFLGEMPTPFVVLSLVPIVGGVALASLTEAS FNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNITLFSIITVMSFFLLAPVTLLTEG VKVTPTVLQSAGLNLKQIYTRSLIAAFCFHAYQQVSYMILARVSPVTHSVGNCVKRVVVI VTSVLFFRTPVSPINSLGTGVALAGVFLYSQLKRLKPKPKTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details