Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 8 (TAAR8)

This Recombinant Human Trace amine-associated receptor 8 (TAAR8) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8, TaR-8, Trace amine receptor 8, G-protein coupled receptor 102, Trace amine receptor 5, TaR-5

UniProt

Q969N4

Expression Region

1-342

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK QLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRA3 Protein Vector (Human) (pPM-C-HA)
PV017039 500 ng

GABRA3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DnaJ (E. coli), (recombinant) (His-tag)
ADI-SPP-640-F 200 µg

DnaJ (E. coli), (recombinant) (His-tag)

Sign In for Pricing
View Details
ARHGAP39 Peptide
orb1232350 0.05 mg

ARHGAP39 Peptide

Sign In for Pricing
View Details
Cat CD8 alpha/beta Antibody (RPE)
GWB-Q00872 100 Tests

Cat CD8 alpha/beta Antibody (RPE)

Sign In for Pricing
View Details
OR5BE1P-set siRNA/shRNA/RNAi Lentivector (Human)
35410091 4x 500 ng

OR5BE1P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 9 (MMP9) ELISA Kit
RDR-MMP9-Ra-01 96 Tests

Rat Matrix Metalloproteinase 9 (MMP9) ELISA Kit

Sign In for Pricing
View Details