Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 8 (TAAR8)

This Recombinant Human Trace amine-associated receptor 8 (TAAR8) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8, TaR-8, Trace amine receptor 8, G-protein coupled receptor 102, Trace amine receptor 5, TaR-5

UniProt

Q969N4

Expression Region

1-342

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK QLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor Activator Of Nuclear Factor Kappa B (RANk) Magnetic Luminex Assay Kit
LKU604422 96 Tests

Receptor Activator Of Nuclear Factor Kappa B (RANk) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Cytochrome p450 2J2 Antibody
orb1335812 100 µg

Cytochrome p450 2J2 Antibody

Sign In for Pricing
View Details
Anti-CDH17 / Cadherin-17 Reference Antibody (PTA001_A4)
E24CHB230 100 µg

Anti-CDH17 / Cadherin-17 Reference Antibody (PTA001_A4)

Sign In for Pricing
View Details
Integrin beta1 (Ab-788) Antibody
MBS859455-01 0.1 mg

Integrin beta1 (Ab-788) Antibody

Sign In for Pricing
View Details
Integrin beta1 (Ab-788) Antibody
MBS859455-02 0.1 mL (AF635)

Integrin beta1 (Ab-788) Antibody

Sign In for Pricing
View Details
Integrin beta1 (Ab-788) Antibody
MBS859455-03 0.1 mL (AF610)

Integrin beta1 (Ab-788) Antibody

Sign In for Pricing
View Details