Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 8 (TAAR8)

This Recombinant Human Trace amine-associated receptor 8 (TAAR8) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8, TaR-8, Trace amine receptor 8, G-protein coupled receptor 102, Trace amine receptor 5, TaR-5

UniProt

Q969N4

Expression Region

1-342

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK QLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACKR3 Human shRNA Plasmid Kit (Locus ID 57007)
TR305345 1 Kit

ACKR3 Human shRNA Plasmid Kit (Locus ID 57007)

Sign In for Pricing
View Details
TOX4 cDNA Clone
MBS1268994-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TOX4 cDNA Clone

Sign In for Pricing
View Details
TOX4 cDNA Clone
MBS1268994-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TOX4 cDNA Clone

Sign In for Pricing
View Details
Human C mL1 EGFP HEK293 Cell Line
E24XCA304 1 Vial

Human C mL1 EGFP HEK293 Cell Line

Sign In for Pricing
View Details
SYN1 Antibody
E30AC890 100 µL

SYN1 Antibody

Sign In for Pricing
View Details
Lentiviral human TNP1 sgRNA gene knockout kit - Lentiviral human TNP1 sgRNA gene knockout kit (100)
GTR15362740 1 Vial

Lentiviral human TNP1 sgRNA gene knockout kit - Lentiviral human TNP1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details