Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51F2 (OR51F2)

This Recombinant Human Olfactory receptor 51F2 (OR51F2) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Olfactory receptor 51F2, Olfactory receptor OR11-23

UniProt

Q8NH61

Expression Region

1-342

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETSLSSQCFPMSVLNNTIAEPLIFLLMGIPGLKATQYWISIPFCLLYVVAVSGNSMIL FVVLCERSLHKPMYYFLSMLSATDLSLSLCTLSTTLGVFWFEAREINLNACIAQMFFLHG FTFMESGVLLAMAFDRFVAICYPLRYTTILTNARIAKIGMSMLIRNVAVMLPVMLFVKRL SFCSSMVLSHSYCYHVDLIQLSCTDNRINSILGLFALLSTTGFDCPCILLSYILIIRSVL SIASSEERRKAFNTCTSHISAVSIFYLPLISLSLVHRYGHSAPPFVHIIMANVFLLIPPV LNPIIYSVKIKQIQKAIIKVLIQKHSKSNHQLFLIRDKAIYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC689757 3'UTR Lenti-reporter-Luc Vector
27460086 1.0 µg

LOC689757 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CSNK1G3 Protein Vector (Mouse) (pPM-C-HA)
PV168444 500 ng

CSNK1G3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CDK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2756707 1.0 µg DNA

CDK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Vgl4 (VGLL4) (NM_001284390) Human Tagged ORF Clone
RC237257 10 µg

Vgl4 (VGLL4) (NM_001284390) Human Tagged ORF Clone

Sign In for Pricing
View Details
Desmethyl Celecoxib
BUP11067-01 10 mg

Desmethyl Celecoxib

Sign In for Pricing
View Details
Desmethyl Celecoxib
BUP11067-02 25 mg

Desmethyl Celecoxib

Sign In for Pricing
View Details