Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-activating factor receptor (PTAFR)

This Recombinant Human Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P25105

Expression Region

1-342

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF6 Human shRNA Plasmid Kit (Locus ID 3664)
TR312109 1 Kit

IRF6 Human shRNA Plasmid Kit (Locus ID 3664)

Sign In for Pricing
View Details
Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail
E-AB-FC0029-01 20 Tests

Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail

Sign In for Pricing
View Details
Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail
E-AB-FC0029-02 100 Tests

Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail

Sign In for Pricing
View Details
Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail
E-AB-FC0029-03 2x 100 Tests

Anti-Human CD45-FITC/CD3-PE/Cyanine5/CD4-PE/CD8-PE/Elab Fluor® 594 Cocktail

Sign In for Pricing
View Details
ANGPTL8 Rabbit Polyclonal Antibody (BF488)
orb2521214 100 µL

ANGPTL8 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details