Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-activating factor receptor (PTAFR)

This Recombinant Human Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P25105

Expression Region

1-342

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cytokeratin 10 Antibody [Alexa Fluor 350]
NBP2-99090AF350 0.1 mL

Rabbit Polyclonal Cytokeratin 10 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control, APC
MBS8503605-01 50 Tests

Mouse IgG1 Isotype Control, APC

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control, APC
MBS8503605-02 100 Tests

Mouse IgG1 Isotype Control, APC

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control, APC
MBS8503605-03 5x 100 Tests

Mouse IgG1 Isotype Control, APC

Sign In for Pricing
View Details
Human Relaxin-3 (RLN3) Elisa Kit
EK713553 96 Well

Human Relaxin-3 (RLN3) Elisa Kit

Sign In for Pricing
View Details
SDF4 Antibody
E311188 200 µL

SDF4 Antibody

Sign In for Pricing
View Details