Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-activating factor receptor (PTAFR)

This Recombinant Human Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P25105

Expression Region

1-342

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM199 Antibody (N-term)
E45R04540G-4 50 µL

TMEM199 Antibody (N-term)

Sign In for Pricing
View Details
Rabbit Monoclonal T-bet/TBX21 Antibody (JE60-20)
NBP3-32908 100 µL

Rabbit Monoclonal T-bet/TBX21 Antibody (JE60-20)

Sign In for Pricing
View Details
GLUT2 antibody
20R-GR008 100 ul

GLUT2 antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Calponin 1 Antibody (CNN1/1408R) [DyLight 594]
NBP2-54378DL594 0.1 mL

Rabbit Monoclonal Calponin 1 Antibody (CNN1/1408R) [DyLight 594]

Sign In for Pricing
View Details
Rabbit Anti-Human SOD1 Polyclonal Antibody
PA84888HU-01 50 µg

Rabbit Anti-Human SOD1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human SOD1 Polyclonal Antibody
PA84888HU-02 100 µg

Rabbit Anti-Human SOD1 Polyclonal Antibody

Sign In for Pricing
View Details