Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 3 (Fpr-rs3)

This Recombinant Mouse Formyl peptide receptor-related sequence 3 (Fpr-rs3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 3

UniProt

O88537

Expression Region

1-343

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEANSSIPLNGSEVVFYDSTTSRVLWILSVIVLSITFVLGVLGNGLVIWVAGFRMAHTVT TICYLNLALGDFSFMVTLPLHIISMVMKGKWLFGWFLCKFVLSIVHINLFVSVFLITLIA MDRCTCVLHPVWVQNHRTVSLARKVIVGAWILSLLLTLPHFLFLTTVRDARGEVHCTCNF ESVVANPEEQLKVSITVSTATGIISFIIGFSLPMSFIAVCYGLMAAKICRKGFLNSSRPL RVLTAVAISFFMCWFPFQLIILLGNIWNKETPSSIHILLNPASTLASFNSCLNPILYVFL GQEFREKLIYSLSASLERALREDSVLSSGKSSNFSSCPADSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster PHD finger protein rhinoceros (rno), partial
MBS1299399 Inquire

Recombinant Drosophila melanogaster PHD finger protein rhinoceros (rno), partial

Sign In for Pricing
View Details
Abcg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3915007 1.0 µg DNA

Abcg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
RPN1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62872R-APC-Cy7 100 µL

RPN1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Sirtuin 1 (SIRT1)
MBS2027955-01 0.1 mL

Polyclonal Antibody to Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details
Polyclonal Antibody to Sirtuin 1 (SIRT1)
MBS2027955-02 0.2 mL

Polyclonal Antibody to Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details
Polyclonal Antibody to Sirtuin 1 (SIRT1)
MBS2027955-03 0.5 mL

Polyclonal Antibody to Sirtuin 1 (SIRT1)

Sign In for Pricing
View Details