Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Thromboxane A2 receptor (TBXA2R)

This Recombinant Bovine Thromboxane A2 receptor (TBXA2R) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Thromboxane A2 receptor, TXA2-R, Prostanoid TP receptor

UniProt

Q95125

Expression Region

1-343

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWPNASSLGPCFRPMNITLEERRLIASPWFAASFCLVGLASNLLALSVLMGARQGSSQSR SSFLTFLCGLVLTDFMGLLVTGAIVVTQHFVLFEWQAVDPGCSLCHFMGVIMVFFGLCPL LLGAAMASERFLGITRPFSRPATASQRRAWTTVGLVWASALALGLLPLLGVGHYTVQYPG SWCFLTLGTDPGDVAFGLLFALLGSISVGMSFLLNTISVATLCHVYHGQATAQQRPRDCE VEMMVQLMGIMVVASICWMPLLVFIAQTVLQSPPAMSPTGQLSRLTERQLLIYLRVATWN QILDPWVYILFRRAVIQRFYPRLSTRSRSLSLQPQLTRRSTIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-01 20 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-02 100 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-03 500 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-04 1 mg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
MLD Recombinant Rabbit monoclonal Antibody
HA750817 100 µL

MLD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]
TA501630AM 100 µL

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]

Sign In for Pricing
View Details