Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hydroxycarboxylic acid receptor 1 (Hcar1)

This Recombinant Mouse Hydroxycarboxylic acid receptor 1 (Hcar1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Hydroxycarboxylic acid receptor 1, G-protein coupled receptor 81

UniProt

Q8C131

Expression Region

1-343

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNGSCCLIEGEPISQVMPPLLILVFVLGALGNGIALCGFCFHMKTWKSSTIYLFNLAVA DFLLMICLPLRTDYYLRRRHWIFGDIACRLVLFKLAMNRAGSIVFLTVVAVDRYFKVVHP HHMVNAISNRTAAATACVLWTLVILGTVYLLMESHLCVQGTLSSCESFIMESANGWHDVM FQLEFFLPLTIILFCSVNVVWSLRRRQQLTRQARMRRATRFIMVVASVFITCYLPSVLAR LYFLWTVPTSACDPSVHTALHVTLSFTYLNSMLDPLVYYFSSPSLPKFYTKLTICSLKPK RPGRTKTRRSEEMPISNLCSKSSIDGANRSQRPSDGQWDLQVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF405S conjugate, 0.1mg/mL
BNC042748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF488A conjugate, 0.1mg/mL
BNC880954-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL
BNC882559-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL
BNC040500-100 1x 100 µL

Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF640R conjugate, 0.1mg/mL
BNC402347-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details