Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E3 (OR1E3)

This Recombinant Human Olfactory receptor 1E3 (OR1E3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Olfactory receptor 1E3, Olfactory receptor 17-210, OR17-210, Olfactory receptor OR17-7

UniProt

Q8WZA6

Expression Region

1-343

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMY LCLSNLSFSDLCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAY HCYVAICFPLHYTTIMSPKCCLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCD TSTLLKLACSNTQVNGWVMFFMGGLILVIPFLLLIMSCARIVSTILRVPSTGGIQKAFST CGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTGVTHMLNPFIYSLRNRDMRGN PGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp4r1 AAV siRNA Pooled Vector
37494164 1.0 µg

Ppp4r1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 6K3 (OR6K3) ELISA Kit
GTR10355241 96 Well

Guinea Pig Olfactory receptor 6K3 (OR6K3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) Protein
abx069430-01 10 µg

Rat Transforming Growth Factor Beta 2 (TGFb2) Protein

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) Protein
abx069430-02 50 µg

Rat Transforming Growth Factor Beta 2 (TGFb2) Protein

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) Protein
abx069430-03 100 µg

Rat Transforming Growth Factor Beta 2 (TGFb2) Protein

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) Protein
abx069430-04 200 µg

Rat Transforming Growth Factor Beta 2 (TGFb2) Protein

Sign In for Pricing
View Details