Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-27 (sra-27)

This Recombinant Serpentine receptor class alpha-27 (sra-27) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-27, Protein sra-27

UniProt

Q19549

Expression Region

1-344

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMYTNQTAEELETWRCTSDGIFKSQNSIWMKINFVFVFILIFLTFYLSFKAARVLKNHN VYSKGSQILLMITLLNANLNQLIFLEIRIRHLVHIFINSEDPCKIEFHSPECTYDQTIYA FTSVMSTGLLSALTFDRFFALYASTVYVRNSKDSAYMLITVSIIVTVIVHIRTYGGVSRA GYVPSCTYPPQLSLNTYQVVNNAIFWIIMANCVLTIAVLLLNIYKDKRIKKSVFDTKTRY NSFENVLTTKAICSVTSTQFVFLSFSTAALAIIRTLEAGMSEEVFHINIQYINGGVYGNL SIPVLIYLKTNQCILQRRKSIDKMTNHTGTVDSHISSLKTAWET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAEP Antibody (Center) Blocking Peptide
MBS9220912-01 0.5 mg

PAEP Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
PAEP Antibody (Center) Blocking Peptide
MBS9220912-02 5x 0.5 mg

PAEP Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
STING (TMEM173) (AK095896) Human Untagged Clone
SC102596 10 µg

STING (TMEM173) (AK095896) Human Untagged Clone

Sign In for Pricing
View Details
NCOA3 Rabbit Polyclonal Antibody (Biotin)
orb458581 100 µL

NCOA3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal CRIP2 Antibody [CoraFluor 1]
NBP3-18431CL1 0.1 mL

Rabbit Polyclonal CRIP2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Methyl [[1-[4-[[ (4-Fluorobenzyl) amino]carbonyl]-5-hydroxy-1-methyl-6-oxo-1,6-dihydropyrimidin-2-yl]-1-methylethyl]amino] (oxo) acetate
454607-01 1 mg

Methyl [[1-[4-[[ (4-Fluorobenzyl) amino]carbonyl]-5-hydroxy-1-methyl-6-oxo-1,6-dihydropyrimidin-2-yl]-1-methylethyl]amino] (oxo) acetate

Sign In for Pricing
View Details