Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8c (Taar8c)

This Recombinant Mouse Trace amine-associated receptor 8c (Taar8c) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8c, TaR-8c, Trace amine receptor 8c

UniProt

Q5QD05

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVYGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQVVVNQDWVLISFLLFFIPTVVMIILYSKIFLVAKQQAVKIETSVSGNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDALVDAFMGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTNLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FEN1 Antibody
RC-7027-01 50 μL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details
Recombinant FEN1 Antibody
RC-7027-02 100 µL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details
Recombinant FEN1 Antibody
RC-7027-03 1 mL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
AP02722PU-S 50 µL

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF18 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF810147 100 µg

ZNF18 Mouse Monoclonal Antibody [Clone ID: OTI2C1]

Sign In for Pricing
View Details
DHRS9 (NM_001142270) Human Recombinant Protein
TP326895M 100 µg

DHRS9 (NM_001142270) Human Recombinant Protein

Sign In for Pricing
View Details