Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8b (Taar8b)

This Recombinant Mouse Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b

UniProt

Q5QD06

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQIVVNQDWVLIDFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSDNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDSLVDAFVGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGEILKSHSSTMSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HDGFL1 Protein, His, E.coli-2ug
QP12207-2ug 2ug

Recombinant Human HDGFL1 Protein, His, E.coli-2ug

Sign In for Pricing
View Details
PRC1 (NM_003981) Human Tagged Lenti ORF Clone
RC201141L4 10 µg

PRC1 (NM_003981) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD22 Antibody *HIB22*
102200J1-AAT 500 Tests

IFluor® 700 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
BMPR1A (NM_004329) Human Recombinant Protein
PH39070M5 20 µg

BMPR1A (NM_004329) Human Recombinant Protein

Sign In for Pricing
View Details
DGCR2 Antibody Blocking Peptide
orb1501368 500 µg

DGCR2 Antibody Blocking Peptide

Sign In for Pricing
View Details
PAG (Phosphoprotein Associated With Glycosphingolipid-Enriched Microdomains 1, Transmembrane Adapter Protein PAG, Csk-Binding Protein, Transmembrane Phosphoprotein Cbp, PAG1, CBP) (MaxLight 490) discontinued
P1951-10-ML490 100 µL

PAG (Phosphoprotein Associated With Glycosphingolipid-Enriched Microdomains 1, Transmembrane Adapter Protein PAG, Csk-Binding Protein, Transmembrane Phosphoprotein Cbp, PAG1, CBP) (MaxLight 490) discontinued

Sign In for Pricing
View Details