Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8b (Taar8b)

This Recombinant Mouse Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b

UniProt

Q5QD06

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQIVVNQDWVLIDFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSDNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDSLVDAFVGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGEILKSHSSTMSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAFF (B cell Activating Factor belonging to TNF Family, BLyS, TALL-1, THANK) (MaxLight 750) discontinued
B0003-64R-ML750 100 µL

BAFF (B cell Activating Factor belonging to TNF Family, BLyS, TALL-1, THANK) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ARF6 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV681035 1.0 µg DNA

ARF6 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Endomucin (EMCN) (NM_016242) Human Over-expression Lysate
LH09994V 100 µg

Endomucin (EMCN) (NM_016242) Human Over-expression Lysate

Sign In for Pricing
View Details
(3-Chlorophenyl) (3-methoxyphenyl) methanone
OR1091860 1 Each

(3-Chlorophenyl) (3-methoxyphenyl) methanone

Sign In for Pricing
View Details
CATSPER4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-6422R-BF647 100 µL

CATSPER4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Bcl-2 Antibody (124) [PE]
NBP2-34513PE 0.1 mL

Mouse Monoclonal Bcl-2 Antibody (124) [PE]

Sign In for Pricing
View Details