Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8b (Taar8b)

This Recombinant Mouse Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b

UniProt

Q5QD06

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQIVVNQDWVLIDFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSDNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDSLVDAFVGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGEILKSHSSTMSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rho Guanine Nucleotide Exchange Factor 4,ARHGEF4 ELISA KIT
JOT-EK1075Ra-01 96 Well

Rat Rho Guanine Nucleotide Exchange Factor 4,ARHGEF4 ELISA KIT

Sign In for Pricing
View Details
Rat Rho Guanine Nucleotide Exchange Factor 4,ARHGEF4 ELISA KIT
JOT-EK1075Ra-02 48 Well

Rat Rho Guanine Nucleotide Exchange Factor 4,ARHGEF4 ELISA KIT

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)
MBS1217542-01 0.05 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)
MBS1217542-02 0.2 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)
MBS1217542-03 0.05 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)
MBS1217542-04 0.5 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Short-chain Z-isoprenyl diphosphate synthase (Rv1086, MT1118)

Sign In for Pricing
View Details