Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8a (Taar8a)

This Recombinant Mouse Trace amine-associated receptor 8a (Taar8a) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8a, TaR-8a, Trace amine receptor 8a

UniProt

Q5QD07

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVYGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSVL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQIVINQDFVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDALVDAFMGFITPAYVYEICCWG TYYNSAMNPLIYAFFFPWFKKAIKLILSGEILKGHSSTANLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHEA (Dehydroepiandrosterone, Prasterone) (Biotin) discontinued. see D3224-98F
D3224-98F-Biotin 100 µL

DHEA (Dehydroepiandrosterone, Prasterone) (Biotin) discontinued. see D3224-98F

Sign In for Pricing
View Details
IL-33 Monoclonal Antibody (Detector)
AN002670P-01 25 µg

IL-33 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
IL-33 Monoclonal Antibody (Detector)
AN002670P-02 100 µg

IL-33 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
IL-33 Monoclonal Antibody (Detector)
AN002670P-03 1 mg

IL-33 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
Eukaryotic Brain Derived Neurotrophic Factor (BDNF)
MBS2139912-01 0.01 mg

Eukaryotic Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details
Eukaryotic Brain Derived Neurotrophic Factor (BDNF)
MBS2139912-02 0.05 mg

Eukaryotic Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details