Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 8a (Taar8a)

This Recombinant Mouse Trace amine-associated receptor 8a (Taar8a) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8a, TaR-8a, Trace amine receptor 8a

UniProt

Q5QD07

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVYGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSVL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQIVINQDFVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDALVDAFMGFITPAYVYEICCWG TYYNSAMNPLIYAFFFPWFKKAIKLILSGEILKGHSSTANLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B7-H6 Protein
orb2994193-01 10 µg

Recombinant Human B7-H6 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H6 Protein
orb2994193-02 50 µg

Recombinant Human B7-H6 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H6 Protein
orb2994193-03 500 µg

Recombinant Human B7-H6 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H6 Protein
orb2994193-04 1 mg

Recombinant Human B7-H6 Protein

Sign In for Pricing
View Details
ZNF502 (Zinc Finger Protein 502, ZNF502) (MaxLight 490)
MBS6460590-01 0.1 mL

ZNF502 (Zinc Finger Protein 502, ZNF502) (MaxLight 490)

Sign In for Pricing
View Details
ZNF502 (Zinc Finger Protein 502, ZNF502) (MaxLight 490)
MBS6460590-02 5x 0.1 mL

ZNF502 (Zinc Finger Protein 502, ZNF502) (MaxLight 490)

Sign In for Pricing
View Details