Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cebuella pygmaea Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Cebuella pygmaea Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I0

Expression Region

1-344

Origin

Cebuella pygmaea (Pygmy marmoset) (Callithrix pygmaea)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSWWPGCWAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-100 1x 100 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF405S conjugate, 0.1mg/mL
BNC040900-500 1x 500 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL
BNC740020-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF568 conjugate, 0.1mg/mL
BNC680200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details