Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix argentata Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Callithrix argentata Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H9

Expression Region

1-344

Origin

Callithrix argentata (Silvery marmoset) (Mico argentatus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVTSVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSWWPGCGAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS710798 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
(R,S)-Nornicotine
TRC-N757000-25MG 25 mg

(R,S)-Nornicotine

Sign In for Pricing
View Details
Copper Strip Corrosion Tester BPTL-257
BPTL-257 1 Unit

Copper Strip Corrosion Tester BPTL-257

Sign In for Pricing
View Details
Human NARG1 (NAA15) activation kit by CRISPRa
GA112842 1 Kit

Human NARG1 (NAA15) activation kit by CRISPRa

Sign In for Pricing
View Details
Small leucine rich protein 1 (SmLR1) Human Gene Knockout Kit (CRISPR)
KN430944 1 Kit

Small leucine rich protein 1 (SmLR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CRIP3 Human Gene Knockout Kit (CRISPR)
KN417450 1 Kit

CRIP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details