Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callimico goeldii Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Callimico goeldii Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H6

Expression Region

1-344

Origin

Callimico goeldii (Goeldi's marmoset)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVPIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLAVSDLLVSGSNMLETAIILLLEAGALVTRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHMTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSRWPGCWAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL
BNC401526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL
BNC740693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details