Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H7

Expression Region

1-344

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYYFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSSWPGCWAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccn5 Mouse Gene Knockout Kit (CRISPR)
KN519438 1 Kit

Ccn5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RUNX2 (NM_001024630) Human Over-expression Lysate
LY400402 100 µg

RUNX2 (NM_001024630) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human IL1R2/CD121b Protein (Fc Tag)
PKSH032561-01 10 µg

Recombinant Human IL1R2/CD121b Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL1R2/CD121b Protein (Fc Tag)
PKSH032561-02 50 µg

Recombinant Human IL1R2/CD121b Protein (Fc Tag)

Sign In for Pricing
View Details
Buccutite™ Rapid PE-Cy5.5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*
1316-AAT 2 Labelings

Buccutite™ Rapid PE-Cy5.5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*

Sign In for Pricing
View Details
PDE4A (NM_001111307) Human Over-expression Lysate
LY426362 100 µg

PDE4A (NM_001111307) Human Over-expression Lysate

Sign In for Pricing
View Details