Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H7

Expression Region

1-344

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYYFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSSWPGCWAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM2 Polyclonal Antibody
E-AB-16102-01 20 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-16102-02 60 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-16102-03 120 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-16102-04 200 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) (NM_000417) Human Over-expression Lysate
LC424732 20 µg

IL2 Receptor alpha (IL2RA) (NM_000417) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human sCD163 Protein (His Tag)
PDMH100228-01 20 µg

Recombinant Human sCD163 Protein (His Tag)

Sign In for Pricing
View Details