Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Callithrix jacchus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H7

Expression Region

1-344

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYYFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSSWPGCWAEGGGDSVWPGSCVTLRGPLPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS627489 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cooled Incubator BICL-7909
BICL-7909 1 Unit

Cooled Incubator BICL-7909

Sign In for Pricing
View Details
Tissue FFPE Sections, Metastasis, unknown source
CS804579 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
CD272 (BTLA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA505688AM 100 µL

CD272 (BTLA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Human ADCK5 activation kit by CRISPRa
GA116426 1 Kit

Human ADCK5 activation kit by CRISPRa

Sign In for Pricing
View Details
MIER1 Rabbit Polyclonal Antibody
TA370028 100 µL

MIER1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details