Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77)

This Recombinant Mouse C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor C5L2, G-protein coupled receptor 77

UniProt

Q8BW93

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNHTTSEYYDYEYDHEHYSDLPDVPVDCPAGTCFTSDVYLIVLLVLYAAVFLVGVPGNT LVAWVTWKESRHRLGASWFLHLTMADLLCCVSLPFLAVPIAQKGHWPYGAAGCWLLSSIT ILSMYASVLLLTGLSGDLFLLAFRPSWKGADHRTFGVRVVQASSWMLGLLLTVPSAVYRR LLQEHYPPRLVCGIDYGGSVSAEVAITTVRFLFGFLGPLVFMAGCHGILQRQMARRHWPL GTAVVVGFFICWTPYHVLRVIIAAAPPHSLLLARVLEAEPLFNGLALAHSALNPIMFLYF GRKQLCKSLQAACHWALRDPQDEESAVTKVSISTSHEMVSEMPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), 0.2mg/mL
BNUB0851-500 1x 500 µL

HSP60 (LK1), 0.2mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL
BNC740767-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF568 conjugate, 0.1mg/mL
BNC680612-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details