Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 8a (Taar8a)

This Recombinant Rat Trace amine-associated receptor 8a (Taar8a) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8a, TaR-8a, Trace amine receptor 8a, Trace amine receptor 11, TaR-11

UniProt

Q923X9

Expression Region

1-344

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQAPLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAFCYSSLF HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISATGIENLV SALNCVGGCQIVVNQDWVLIDFLLFLIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGE SSLESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDTLIDAFMGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGEILKSHSSTMSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM4 (NM_001080454) Human Over-expression Lysate
LY420712 100 µg

ACSM4 (NM_001080454) Human Over-expression Lysate

Sign In for Pricing
View Details
TentaGel® MB PHB
MB300130.5G 5 g

TentaGel® MB PHB

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF647 conjugate, 0.1mg/mL
BNC472960-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509087 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
5-H-Octafluoropentanoic Acid
TRC-O273148-500MG 500 mg

5-H-Octafluoropentanoic Acid

Sign In for Pricing
View Details
Cefoperazone Acid
TRC-C242903-250MG 250 mg

Cefoperazone Acid

Sign In for Pricing
View Details